Overview

  • Product name

    Recombinant Human VPS45A protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MNVVFAVKQYISKMIEDSGPGMKVLLMDKETTGIVSMVYTQSEILQKEVY LFERIDSQNREIMKHLKAICFLRPTKENVDYIIQELRRPKYTIYFIYFSN VISKSDVKSLAEADEQEVVAEVQEFYGDYIAVNPHLFSLNILGCCQGRNW DPAQLSRTTQGLTALLLSLKKCPMIRYQLSSEAAKRLAECVKQVITKEYE LFEFRRTEVPPLLLILDRCDDAITPLLNQWTYQAMVHELLGINNNRIDLS RVPGISKDLREVVLSAENDEFYANNMYLNFAEIGSNIKNLMEDFQKKKPK EQQKLESIADMKAFVENYPQFKKMSGTVSKHVTVVGELSRLVSERNLLEV SEVEQELACQNDHSSALQNIKRLLQNPKVTEFDAARLVMLYALHYERHSS NSLPGLMMDLRNKGVSEKYRKLVSAVVEYGGKRVRGSDLFSPKDAVAITK QFLKGLKGVENVYTQHQPFLHETLDHLIKGRLKENLYPYLGPSTLRDRPQ DIIVFVIGGATYEEALTVYNLNRTTPGVRIVLGGTTVHNTKSFLEEVLAS GLHSRSKESSQVTSRSASRR
    • Molecular weight

      92 kDa including tags
    • Amino acids

      1 to 570

Specifications

Our Abpromise guarantee covers the use of ab132475 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • h-VPS45
    • H1
    • H1VPS45
    • HGNC:14579
    • hlVps45
    • Leucocyte vacuolar protein sorting 45
    • OTTHUMP00000014482
    • Vacuolar protein sorting 45 homolog (S. cerevisiae)
    • Vacuolar protein sorting 45A
    • Vacuolar protein sorting 45A (yeast homolog)
    • Vacuolar protein sorting 45B (yeast)
    • Vacuolar protein sorting-associated protein 45
    • Vps45
    • VPS45_HUMAN
    • VPS45A
    • VPS45B
    • VPS54A
    • VSP45
    • VSP45A
    see all
  • Function

    May play a role in vesicle-mediated protein trafficking from the Golgi stack through the trans-Golgi network.
  • Tissue specificity

    Ubiquitous. Expression was highest in testis, heart and brain, intermediate in kidney, spleen, prostate, ovary, small intestine and thymus and low in lung, skeletal muscle, placenta, colon, pancreas, peripheral blood leukocytes and liver.
  • Sequence similarities

    Belongs to the STXBP/unc-18/SEC1 family.
  • Cellular localization

    Golgi apparatus membrane. Endosome membrane. Associated with Golgi/endosomal vesicles and the trans-Golgi network.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132475 stained with Coomassie Blue

References

ab132475 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132475.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up