Description

  • Product name

    Recombinant Human VPS53 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MMEEEELEFVEELEAVLQLTPEVQLAIEQVFPSQDPLDRADFNAVEYINT LFPTEQSLANIDEVVNKIRLKIRRLDDNIRTVVRGQTNVGQDGRQVKEIT RDIKQLDHAKRHLTTSITTLNHLHMLAGGVDSLEAMTRRRQYGEVANLLQ GVMNVLEHFHKYMGIPQIRQLSERVKAAQTELGQQILADFEEAFPSQGTK RPGGPSNVLRDACLVANILDPRIKQEIIKKFIKQHLSEYLVLFQENQDVA WLDKIDRRYAWIKRQLVDYEEKYGRMFPREWCMAERIAVEFCHVTRAELA KIMRTRAKEIEVKLLLFAIQRTTNFEGFLAKRFSGCTLTDGTLKKLESPP PSTNPFLEDEPTPEMEELATEKGDLDQPKKPKAPDNPFHGIVSKCFEPHL YVYIESQDKNLGELIDRFVADFKAQGPPKPNTDEGGAVLPSCADLFVYYK KCMVQCSQLSTGEPMIALTTIFQKYLREYAWKILSGNLPKTTTSSGGLTI SSLLKEKEGSEVAKFTLEELCLICNILSTAEYCLATTQQLEEKLKEKVDV SLIERINLTGEMDTFSTVISSSIQLLVQDLDAACDPALTAMSKMQWQNVE HVGDQSPYVTSVILHIKQNVPIIRDNLASTRKYFTQFCVKFANSFIPKFI THLFKCKPISMVGAEQVRWT
    • Amino acids

      1 to 670
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163041 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ10979
    • FLJ41112
    • FLJ61757
    • HCCS1
    • hVps53L
    • MGC39512
    • pp13624
    • Vacuolar protein sorting 53
    • Vacuolar protein sorting 53 (yeast)
    • Vacuolar protein sorting 53 homolog (S. cerevisiae)
    • Vacuolar protein sorting-associated protein 53 homolog
    • VPS53
    • VPS53_HUMAN
    see all
  • Function

    May be involved in retrograde transport of early and late endosomes to the late Golgi.
  • Sequence similarities

    Belongs to the VPS53 family.
  • Cellular localization

    Golgi apparatus > trans-Golgi network membrane. Endosome membrane.
  • Information by UniProt

Images

  • ab163041 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163041 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163041.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up