Description

  • Product name

    Recombinant human VRK2 protein
    See all VRK2 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPPKRNEKYKLPIPFPEGKVLDDMEGNQWVLGKKIGSGGFGLIYLAFPTN KPEKDARHVVKVEYQENGPLFSELKFYQRVAKKDCIKKWIERKQLDYLGI PLFYGSGLTEFKGRSYRFMVMERLGIDLQKISGQNGTFKKSTVLQLGIRM LDVLEYIHENEYVHGDVKAANLLLGYKNPDQVYLADYGLSYRYCPNGNHK QYQENPRKGHNGTIEFTSLDAHKGVALSRRSDVEILGYCMLRWLCGKLPW EQNLKDPVAVQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAY DEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATK QVNKAHNRLIEKKVHSERSAESCATWKVQKEEKLIGLMNNEAAQESTRRR QKYQESQEPLNEVNSFPQKISYTQFPNSFYEPHQDFTSPDIFKKSRSPSW YKYTSTVSTGITDLESSTGLWPTISQFTLSEETNADVYYYRIIIPVLLML VFLALFFL
    • Predicted molecular weight

      82 kDa including tags
    • Amino acids

      1 to 508

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152799 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 2810003O05Rik
    • AI447698
    • EC 2.7.11.1
    • Serine/threonine protein kinase VRK2
    • Serine/threonine-protein kinase VRK2
    • Vaccinia related kinase 2
    • Vaccinia virus B1R related kinase 2
    • Vaccinia-related kinase 2
    • VRK 2
    • VRK2
    • VRK2_HUMAN
    see all
  • Function

    Probable serine/threonine kinase.
  • Tissue specificity

    Widely expressed. Highly expressed in fetal liver, skeletal muscle, pancreas, heart, peripheral blood leukocytes and testis.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CK1 Ser/Thr protein kinase family. VRK subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152799 stained with Coomassie Blue.
  • Kinase Assay using ab152799 and [gamma 32P] ATP radioisotope.

    Fig.1 SDS-PAGE gel
    Fig.2 Autoradiograph of SDS-PAGE gel

    Kinase substrates:
    H3 histone, family 3A - calf thymus Molecular weight: approx. 16.5-17 kDa on SDS-PAGE
    Myelin basic protein - bovine brain Molecular weight: approx. 21-22 kDa on SDS-PAGE
    Histone H1.0 - calf thymus Molecular weight: approx. 32-33 kDa on SDS-PAGE
    Beta-casein protein - bovine milk Molecular weight: approx. 33-34 kDa on SDS-PAGE

References

ab152799 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152799.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up