Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKR GLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLSSSERSKGSGS RPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTLKRSRVTTSLE ALPTGTVLTDKSGRQWKLKSFQTRDNQGILYEAAPTSTLTCDSGPQKQKF SLKLDAKDGRLFNEQNFFQRAAKPLQVNKWKKLYSTPLLAIPTCMGFGVH QDKYRFLVLPSLGRSLQSALDVSPKHVLSERSVLQVACRLLDALEFLHEN EYVHGNVTAENIFVDPEDQSQVTLAGYGFAFRYCPSGKHVAYVEGSRSPH EGDLEFISMDLHKGCGPSRRSDLQSLGYCMLKWLYGFLPWTNCLPNTEDI MKQKQKFVDKPGPFVGPCGHWIRPSETLQKYLKVVMALTYEEKPPYAMLR NNLEALLQDLRVSPYDPIGLPMVP
    • Molecular weight

      80 kDa including tags
    • Amino acids

      1 to 474

Specifications

Our Abpromise guarantee covers the use of ab139630 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Purity

    >= 95 % Densitometry.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.31% Glutathione, 0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 0.003% EDTA, 25% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • Inactive serine/threonine-protein kinase VRK3
    • Serine/threonine protein kinase VRK3
    • Serine/threonine-protein pseudokinase VRK3
    • Vaccinia related kinase 3
    • Vaccinia-related kinase 3
    • Vrk3
    • VRK3_HUMAN
    see all
  • Function

    Inactive kinase that suppresses ERK activity by promoting phosphatase activity of DUSP3 which specifically dephosphorylates and inactivates ERK in the nucleus.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CK1 Ser/Thr protein kinase family. VRK subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • SDS PAGE analysis of ab139630

References

ab139630 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139630.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up