Description

  • Product name

    Recombinant Human VSIG4 protein
    See all VSIG4 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFL RDSSGDHIQQ AKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTW QTPDGNQVVRDKITELRVQKLS VSKPTVTTGSGYGFTVPQGMRISLQC QARGSPPISYIWYKQQTNNQEPIKVATLSTLLFK PAVIADSGSYFCTA KGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQ SW DWTTDMDGYLGETSAGPGKSLP
    • Predicted molecular weight

      20 kDa including tags
    • Amino acids

      20 to 283
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab182716 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.40
    Constituents: 97% PBS, 3% Trehalose

    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage

General Info

  • Alternative names

    • Complement receptor of the immunoglobulin superfamily
    • CRIg
    • Ig superfamily protein
    • Protein Z39Ig
    • UNQ317/PRO362
    • V set and immunoglobulin domain containing 4
    • V-set and immunoglobulin domain-containing protein 4
    • VSIG4
    • VSIG4_HUMAN
    • Z39IG
    see all
  • Function

    Phagocytic receptor, strong negative regulator of T-cell proliferation and IL2 production. Potent inhibitor of the alternative complement pathway convertases.
  • Tissue specificity

    Abundantly expressed in several fetal tissues. In adult tissues, highest expression in lung and placenta. Expressed in resting macrophages.
  • Sequence similarities

    Contains 2 Ig-like (immunoglobulin-like) domains.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • The purity of ab182716 was determined by DTT-reduced (+) SDS-PAGE and staining overnight with Coomassie Blue.

References

ab182716 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182716.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up