Description

  • Product name

    Recombinant Human VSIG8 protein (Fc Chimera)
    See all VSIG8 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      VRINGDGQEVLYLAEGDNVRLGCPYVLDPEDYGPNGLDIEWMQVNSDPAH HRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDT ATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMTYGNDVVLKCYASG GSQPLSYKWAKISGHHYPYRAGSYTSQHSYHSELSYQESFHSSINQGLNN GDLVLKDISRADDGLYQCTVANNVGYSVCVVEVKVSDSRRIG
    • Predicted molecular weight

      54 kDa including tags
    • Amino acids

      22 to 263
    • Additional sequence information

      This protein carries a human IgG1 Fc tag at the C-terminus (NP_001013683.1).

Associated products

Specifications

Our Abpromise guarantee covers the use of ab220579 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.75% Glycine, 5% Trehalose, 0.61% Tris

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • C1orf204
    • Chromosome 1 open reading frame 204
    • EG240916
    • FLJ20442
    • FLJ39187
    • Hypothetical protein LOC2846772
    • RP11 190A12.5
    • V set and immunoglobulin domain containing 8
    • V-set and immunoglobulin domain-containing protein 8
    • VSIG8
    • VSIG8_HUMAN
    see all
  • Relevance

    Similarity: Contains 2 Ig-like V-type (immunoglobulin-like) domains.

Images

  • SDS-PAGE analysis of DTT-reduced (lane 1) and non-reduced (lane 2) ab220579 staining overnight with Coomassie Blue. 

    As a result of glycosylation, the protein migrates as 55-65 kDa under reducing conditions, and 110-130 kDa under non-reducing conditions.

References

ab220579 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220579.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up