Overview

  • Product name
    Recombinant Human WAPL protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDLDRASLDLMIRLLELEQDASSAKLLNEKDMNKIKEKIRRLCETVHNKH LDLENITTGHLAMETLLSLTSKRAGDWFKEELRLLGGLDHIVDKVKECVD HLSRDEDEEKLVASLWGAERCLRVLESVTVHNPENQSYLIAYKDSQLIVS SAKALQHCEELIQQYNRAEDSICLADSKPLPHQNVTNHVGKAVEDCMRAI IGVLLNLTNDNEWGSTKTGEQDGLIGTALNCVLQVPKYLPQEQRFDIRVL LFLERERAAQLAESKTDELIKDAPTTQHDKSGEWQETSGEIQWVSTEKTD GTEEKHKKEEEDEELDLNKALQHAGKHMEDCIVASYTALLLGCLCQESPI NVTTVREYLPEGDFSIMTEMLKKFLSFMNLTCAVGTTGQKSISRVIEYLE HC
    • Amino acids
      1 to 402
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161523 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FOE
    • Friend of EBNA2 (Epstein Barr virus nuclear protein 2)
    • Friend of EBNA2 protein
    • KIAA0261
    • OTTHUMP00000020004
    • WAPAL
    • WAPL
    • WAPL_HUMAN
    • Wings apart like homolog
    • Wings apart like homolog (Drosophila)
    • Wings apart-like protein homolog
    see all
  • Function
    Regulator of sister chromatid cohesion in mitosis which negatively regulates cohesin association with chromatin. Involved in both sister chromatid cohesion during interphase and sister-chromatid resolution during early stages of mitosis. Couples DNA replication to sister chromatid cohesion. Cohesion ensures that chromosome partitioning is accurate in both meiotic and mitotic cells and plays an important role in DNA repair.
  • Tissue specificity
    Isoform 1 is highly expressed in uterine cervix tumor. Isoform 2 is widely expressed with a high level in skeletal muscle and heart.
  • Sequence similarities
    Contains 1 WAPL domain.
  • Cellular localization
    Nucleus and Nucleus. Chromosome. Cytoplasm. Associates with chromatin through the cohesin complex during interphase. Released in the cytoplasm from nuclear envelope breakdown until anaphase, it reaccumulates in nucleus at telophase.
  • Information by UniProt

Images

  • ab161523 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161523 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161523.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up