Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MALHSMRKARERWSFIRALHKGSAAAPALQKDSKKRVFSGIQPTGILHLG NYLGAIESWVRLQDEYDSVLYSIVDLHSITVPQDPAVLRQ
    • Amino acids
      1 to 90
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160959 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • (Mt)TrpRS
    • Mitochondrial tryptophanyl tRNA synthetase 2
    • TrpRS
    • Tryptophan tRNA ligase 2
    • Tryptophan tRNA ligase 2 mitochondrial
    • Tryptophanyl tRNA synthetase 2
    • Tryptophanyl tRNA synthetase 2 mitochondrial
    see all
  • Relevance
    Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. This gene encodes the mitochondrial tryptophanyl-tRNA synthetase. Two alternative transcripts encoding different isoforms have been described.
  • Cellular localization
    Mitochondrial matrix.

Images

  • ab160959 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160959 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160959.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up