Recombinant Human WASP/Wiskott-Aldrich syndrome protein (ab152802)

Overview

  • Product name

    Recombinant Human WASP/Wiskott-Aldrich syndrome protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      LPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLV YSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDR RQLPPPPTPANEER
    • Molecular weight

      38 kDa including tags
    • Amino acids

      57 to 170

Specifications

Our Abpromise guarantee covers the use of ab152802 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

     This product was previously labelled as WASP

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Eczema thrombocytopenia
    • IMD2
    • SCNX
    • THC
    • THC1
    • Thrombocytopenia 1 (X linked)
    • U42471
    • Was
    • WASp
    • WASP_HUMAN
    • Wiskott Aldrich syndrome
    • Wiskott Aldrich syndrome (eczema thrombocytopenia)
    • Wiskott Aldrich syndrome protein
    • Wiskott-Aldrich syndrome protein
    see all
  • Function

    Effector protein for Rho-type GTPases, providing a link with the Arp2/3 complex that regulates the structure and dynamics of the actin cytoskeleton. Important for efficient actin polymerization. Possible regulator of lymphocyte and platelet function.
  • Tissue specificity

    Expressed predominantly in the thymus. Also found, to a much lesser extent, in the spleen.
  • Involvement in disease

    Defects in WAS are the cause of Wiskott-Aldrich syndrome (WAS) [MIM:301000]; also known as eczema-thrombocytopenia-immunodeficiency syndrome. WAS is an X-linked recessive immunodeficiency characterized by eczema, thrombocytopenia, recurrent infections, and bloody diarrhea. Death usually occurs before age 10.
    Defects in WAS are the cause of thrombocytopenia type 1 (THC1) [MIM:313900]. Thrombocytopenia is defined by a decrease in the number of platelets in circulating blood, resulting in the potential for increased bleeding and decreased ability for clotting.
    Defects in WAS are a cause of neutropenia severe congenital X-linked (XLN) [MIM:300299]. XLN is an immunodeficiency syndrome characterized by recurrent major bacterial infections, severe congenital neutropenia, and monocytopenia.
  • Sequence similarities

    Contains 1 CRIB domain.
    Contains 1 WH1 domain.
    Contains 1 WH2 domain.
  • Domain

    The WH1 (Wasp homology 1) domain may bind a Pro-rich ligand.
    The CRIB (Cdc42/Rac-interactive-binding) region binds to the C-terminal WH2 domain in the autoinhibited state of the protein. Binding of Rho-type GTPases to the CRIB induces a conformation change and leads to activation.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152802 stained with Coomassie Blue.

References

ab152802 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152802.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up