Overview

  • Product name

    Recombinant Human WAVE 1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      HDRRREWQKLAQGPELAEDDANLLHKHIEVANGPASHFETRPQTYVDHMD GSYSLSALPFSQMSELLTRAEERVLVRPHEPPPPPPMHGAGDAKPIPTCI
    • Amino acids

      198 to 297
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152938 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • WASP family, verprolin homology domain-containing protein 1
    • WASP family member 1
    • FLJ31482
    • homology of dictyostelium scar 1
    • KIAA0269
    • Protein WAVE-1
    • Protein WAVE1
    • scar, Dictyostelium, homology of, 1
    • SCAR1
    • Similar to a plant extensin like protein
    • Verprolin homology domain containing protein 1
    • Verprolin homology domain-containing protein 1
    • WAS protein family, member 1
    • Wasf1
    • WASF1_HUMAN
    • WASL
    • WASP family 1
    • WASP family protein member 1
    • WASP family, verprolin homology domain-containing protein
    • WAVE
    • WAVE1
    • Wiskott Aldrich syndrome protein family member 1
    • Wiskott-Aldrich syndrome protein family member 1
    see all
  • Function

    Downstream effector molecule involved in the transmission of signals from tyrosine kinase receptors and small GTPases to the actin cytoskeleton. Promotes formation of actin filaments. Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex.
  • Tissue specificity

    Highly expressed in brain. Lowly expressed in testis, ovary, colon, kidney, pancreas, thymus, small intestine and peripheral blood.
  • Sequence similarities

    Belongs to the SCAR/WAVE family.
    Contains 1 WH2 domain.
  • Domain

    Binds the Arp2/3 complex through the C-terminal region and actin through verprolin homology (VPH) domain.
  • Cellular localization

    Cytoplasm > cytoskeleton. Dot-like pattern in the cytoplasm. Concentrated in Rac-regulated membrane-ruffling areas.
  • Information by UniProt

Images

  • ab152938 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152938 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152938.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up