Description

  • Product name

    Recombinant Human WBP11 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDP KQIIRDMEKLDEMEFNPVQQPQLNEKVLKDKRKKLRETFERILRLYEKEN PDIYKELRKLEVEYEQKRAQLSQYFDAVKNAQHVEVESIPLPDMPHAPSN ILIQDIPLPGAQPPSILKKTSAYGPPTRAVSILPLLGHGVPRLPPGRKPP GPPPGPPPPQVVQMYGRKVGFALDLPPRRRDEDMLYSPELAQRGHDDDVS STSEDDGYPEDMDQDKHDDSTDDSDTDKSDGESDGDEFVHRDNGERDNNE EKKSGLSVRFADMPGKSRKKKKNMKELTPLQAMMLRMAGQEIPEEGREVE EFSEDDDEDDSDDSEAEKQSQKQHKEESHSDGTSTASSQQQAPPQSVPPS QIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGL RGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGIP PPRPGMMRPPLVPPLGPAPPGLFPPAPLPNPGVLSAPPNLIQRPKADDTS AATIEKKATATISAKPQITNPKAEITRFVPTALRVRRENKGATAAPQRKS EDDSAVPLAKAAPKSGPSVPVSVQTKDDVYEAFMKEMEGLL
    • Amino acids

      1 to 641
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162652 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZp779M1063
    • MGC94547
    • Npw38 binding protein
    • Npw38 binding protein NpwBP
    • Npw38-binding protein
    • NpwBP
    • PPP1R165
    • Protein phosphatase 1 regulatory subunit 165
    • SH3 domain binding protein SNP70
    • SH3 domain-binding protein SNP70
    • SIPP1
    • SNP70
    • Splicing factor PQBP1 and PP1 interacting
    • Splicing factor that interacts with PQBP 1 and PP1
    • Splicing factor that interacts with PQBP-1 and PP1
    • WBP 11
    • WBP-11
    • Wbp11
    • WBP11_HUMAN
    • WW domain binding protein 11
    • WW domain-binding protein 11
    see all
  • Function

    Activates pre-mRNA splicing. May inhibit PP1 phosphatase activity.
  • Tissue specificity

    Ubiquitous. Highly expressed in the heart, pancreas, kidney skeletal muscle, placenta and brain (at protein level). Weakly expressed in liver and lung.
  • Cellular localization

    Nucleus. Cytoplasm. Predominantly located in the nucleus with granular heterogeneous distribution. Excluded from nucleoli in interphase cells, distributed throughout cytoplasm in dividing cells. Colocalized with SC35 and U2B in the nucleus. In the cytoplasm, associates with the intermediate filament protein vimentin.
  • Information by UniProt

Images

  • ab162652 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162652 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162652.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up