Overview

  • Product name
    Recombinant Human WBSCR17 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSGDAFHEIRPRAEVAN LSAHSASPIQDAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLP ATLSPAEEEKAKGPHEKYGYNSYLSEKISLDRSIPDYRPTKCKELKYSKD LPQISIIFIFVNEALSVILRSVHSAVNHTPTHLLKEIILVDDNSDEEELK VPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQVTGFFDAHVE FTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELW CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVY GGENIELGIKVWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALR VAEVWMDDYKSHVYIAWNLPLENPGIDIGDVSERRALRKSLKCKNFQWYL DHVYPEMRRYNNTVAYGELRNNKAKDVCLDQGPLENHTAILYPCHGWGPQ LARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLDCDKVKSSLYK RWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQRWTIKNSIK
    • Amino acids
      1 to 598
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163835 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GalNAc-T-like protein 3
    • GALNT16
    • GALNT20
    • GALNTL3
    • GLTL3_HUMAN
    • Polypeptide GalNAc transferase-like protein 3
    • Polypeptide N acetylgalactosaminyltransferase WBSCR17
    • pp GalNAc transferase 20
    • pp-GaNTase-like protein 3
    • Protein-UDP acetylgalactosaminyltransferase-like protein 3
    • Putative polypeptide N-acetylgalactosaminyltransferase-like protein 3
    • UDP GalNAc:polypeptide N acetylgalactosaminyltransferase like 3
    • UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 16
    • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase-like protein 3
    • Wbscr17
    • Williams Beuren syndrome chromosome region 17
    • Williams-Beuren syndrome chromosomal region 17 protein
    see all
  • Function
    May catalyze the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.
  • Tissue specificity
    Highly expressed in brain and heart. Weakly expressed in kidney, liver, lung and spleen.
  • Pathway
    Protein modification; protein glycosylation.
  • Involvement in disease
    Note=WBSCR17 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region.
  • Sequence similarities
    Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.
    Contains 1 ricin B-type lectin domain.
  • Domain
    There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding.
    The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab163835 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163835 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163835.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up