Overview

  • Product name
    Recombinant Human WDFY2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAEIQPKPLTRKPILLQRMEGSQEVVNMAVIVPKEEGVISVSEDRTVRV WLKRDSGQYWPSVYHAMPSPCSCMSFNPETRRLSIGLDNGTISEFILSED YNKMTPVKNYQAHQSRVTMILFVLELEWVLSTGQDKQFAWHCSESGQRLG GYRTSAVASGLQFDVETRHVFIGDHSGQVTILKLEQENCTLVTTFRGHTG GVTALCWDPVQRVLFSGSSDHSVIMWDIGGRKGTAIELQGHNDRVQALSY AQHTRQLISCGGDGGIVVWNMDVERQETPEWLDSDSCQKCDQPFFWNFKQ MWDSKKIGLRQHHCRKCGKAVCGKCSSKRSSIPLMGFEFEVRVCDSCHEA ITDEERAPTATFHDSKHNIVHVHFDATRGWLLTSGTDKVIKLWDMTPVVS
    • Amino acids
      1 to 400
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165083 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PROF
    • Propeller-FYVE protein
    • RP11 147H23.1
    • WD repeat and FYVE domain containing 2
    • WD repeat and FYVE domain-containing protein 2
    • WD40 and FYVE domain containing 2
    • WD40- and FYVE domain-containing protein 2
    • WDF2
    • Wdfy2
    • WDFY2_HUMAN
    • ZFYVE22
    • Zinc finger FYVE domain-containing protein 22
    see all
  • Sequence similarities
    Contains 1 FYVE-type zinc finger.
    Contains 7 WD repeats.
  • Information by UniProt

Images

  • ab165083 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165083 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165083.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up