Overview

  • Product name

    Recombinant Human WDFY3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MGTSKEKAKTATLKQALLGHTDTVTCATASLAYHIIVSGSRDRTCIIWDL NKLSFLTQLRGHRAPVSALCINELTGDIVSCAGTYIHVWSINGNPIVSVN TFTGRSQQIICCCMSEMNEWDTQNVIVTGHSDGVVRFWRMEFLQVPETPA PEPAEVLEMQEDCPEAQIGQEAQDEDSSDSEADEQSISQDPKDTPSQPSS TSHRPRAASCRATAAWCTDSGSDDSRRWSDQLSLDEKDGFIFVNYSEGQT RAHLQGPLSHPHPNPIEVRNYSRLKPGYRWERQLVFRSKLTMHTAFDRKD NAHPAEVTALGISKDHSRILVGDSRGRVFSWSVSDQPGRSAADHWVKDEG GDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKRLKISSPVRVC QNCYYNLQHERGSEDGPRNC
    • Amino acids

      1 to 420
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161496 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Alfy
    • Autophagy linked FYVE protein
    • KIAA0993
    • MGC16461
    • WD repeat and FYVE domain containing 3
    • ZFYVE25
    see all
  • Relevance

    WDFY3 ( WD repeat and FYVE domain containing protein 3) was identified in a screen for phosphatidylinositol 3 phosphate [PtdIns(3)P] binding proteins. The FYVE domain is a zinc binding domain found in many PtdIns(3) binding proteins and is proposed to target proteins to membrane lipids. WDFY3 has been shown localized to the nuclear membrane and within autophagic membranes and it is proposed to function as a link between protein aggregates and the autophagic machinery. WDFY3 is also known as autophagy linked FYVE protein (Alfy).
  • Cellular localization

    Membrane; Peripheral membrane protein; Cytoplasmic side. Note: Colocalizes with autophagic structures in starved cells.

Images

  • ab161496 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161496 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161496.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up