Description

  • Product name

    Recombinant Human WDR21A protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MESKRLRLLQEEDRRKKIARMGFNASSMLRKSQLGFLNVTNYCHLAHELR LSCMERKKVQIRSMDPSALASDRFNLILADTNSDRLFTVNDVKVGGSKYG IINLQSLKTPTLKVFMHENLYFTNRKVNSVCWASLNHLDSHILLCLMGLA ETPGCATLLPASLFVNSHPGIDRPGMLCSFRIPGAWSCAWSLNIQANNCF STGLSRRVLLTNVVTGHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFA IDLRCGNQGKGWKATRLFHDSAVTSVRILQDEQYLMASDMAGKIKLWDLR TTKCVRQYEGHVNEYAYLPLHVHEEEGILVAVGQDCYTRIWSLHDARLLR TIPSPYPASKADIPSVAFSSRLGGSRGAPGLLMAVGQDLYCYSYS
    • Amino acids

      1 to 395
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161895 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DCAF4
    • DCAF4_HUMAN
    • DDB1 and CUL4 associated factor 4
    • DDB1- and CUL4-associated factor 4
    • WD repeat domain 21
    • WD repeat domain 21A
    • WD repeat-containing protein 21A
    • WDR21
    • WDR21A
    see all
  • Function

    May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 2 WD repeats.
  • Information by UniProt

Images

  • ab161895 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161895 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161895.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up