Description

  • Product name

    Recombinant Human WDR68 protein
    See all WDR68 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab205219 was expressed in E.coli as inclusion bodies, refolded using a unique “temperature shift inclusion body refolding” technology, chromatographically purified and sterile-filtered.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGEFSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLAL GSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPD LLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLL GTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAG GGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNY LATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAA DDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNC LEILRV
    • Predicted molecular weight

      40 kDa including tags
    • Amino acids

      2 to 342
    • Tags

      T7 tag N-Terminus
    • Additional sequence information

      NP_005819.

Specifications

Our Abpromise guarantee covers the use of ab205219 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, Sucrose and DTT.

General Info

  • Alternative names

    • AN11
    • Dcaf7
    • DCAF7_HUMAN
    • DDB1- and CUL4-associated factor 7
    • HAN11
    • Human anthocyanin
    • Petunia
    • Seven WD repeat protein of the AN11 family 1
    • SWAN 1
    • WD repeat domain 68
    • WD repeat protein An11 homolog
    • WD repeat-containing protein 68
    • WD repeat-containing protein An11 homolog
    • WDR68
    see all
  • Function

    Involved in craniofacial development. Acts upstream of the EDN1 pathway and is required for formation of the upper jaw equivalent, the palatoquadrate. The activity required for EDN1 pathway function differs between the first and second arches (By similarity). Associates with DIAPH1 and controls GLI1 transcriptional activity. Could be involved in normal and disease skin development. May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the WD repeat DCAF7 family.
    Contains 4 WD repeats.
  • Cellular localization

    Cytoplasm. Nucleus. Overexpression of DIAHP1 or active RHOA causes translocation from the nucleus to cytoplasm.
  • Information by UniProt

References

ab205219 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205219.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up