Description

  • Product name

    Recombinant Human WDR68 protein (denatured)
    See all WDR68 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab111624 was denatured using detergent during conventional chromatography purification process.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMVYAMNWSVRPDKRFRLALGSFVEEYNNKV QLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRV WRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTI WGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGA DGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEV VILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWD
    • Predicted molecular weight

      34 kDa
    • Amino acids

      19 to 295
    • Tags

      His tag N-Terminus
  • Description

    Recombinant Human WDR68 protein

Specifications

Our Abpromise guarantee covers the use of ab111624 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 2.4% Urea

General Info

  • Alternative names

    • AN11
    • Dcaf7
    • DCAF7_HUMAN
    • DDB1- and CUL4-associated factor 7
    • HAN11
    • Human anthocyanin
    • Petunia
    • Seven WD repeat protein of the AN11 family 1
    • SWAN 1
    • WD repeat domain 68
    • WD repeat protein An11 homolog
    • WD repeat-containing protein 68
    • WD repeat-containing protein An11 homolog
    • WDR68
    see all
  • Function

    Involved in craniofacial development. Acts upstream of the EDN1 pathway and is required for formation of the upper jaw equivalent, the palatoquadrate. The activity required for EDN1 pathway function differs between the first and second arches (By similarity). Associates with DIAPH1 and controls GLI1 transcriptional activity. Could be involved in normal and disease skin development. May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the WD repeat DCAF7 family.
    Contains 4 WD repeats.
  • Cellular localization

    Cytoplasm. Nucleus. Overexpression of DIAHP1 or active RHOA causes translocation from the nucleus to cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab111624 at approximately 33.6kDa (3µg).

References

ab111624 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab111624.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up