Overview

  • Product name
    Recombinant Human WDTC1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAKVNITRDLIRRQIKERGALSFERRYHVTDPFIRRLGLEAELQGHSGCV NCLEWNEKGDLLASGSDDQHTIVWDPLHHKKLLSMHTGHTANIFSVKFLP HAGDRILITGAADSKVHVHDLTVKETIHMFGDHTNRVKRIATAPMWPNTF WSAAEDGLIRQYDLRENSKHSEVLIDLTEYCGQLVEAKCLTVNPQDNNCL AVGASGPFVRLYDIRMIHNHRKSMKQSPSAGVHTFCDRQKPLPDGAAQYY VAGHLPVKLPDYNNRLRVLVATYVTFSPNGTELLVNMGGEQVYLFDLTYK QRPYTFLLPRKCHSSGVQNGKMSTNGVSNGVSNGLHLHSNGFRLPESRGH VSPQVELPPYLERVKQQANEAFACQQWTQAIQLYSKAVQRAPHNAMLYGN RAAAYMKRKWDGDHYDALRDCLKAISLNPCHLKAHFRLARCLFELKYVAE ALECLDDFKGKFPEQAHSSACDALGRDITAALFSKNDGEEKKGPGGGAPV RLRSTSRKDSISEDEMVLRERSYDYQFRYCGHCNTTTDIKEANFFGSNAQ YIVSGSDDGSFFIWEKETTNLVRVLQGDESIVNCLQPHPSYCFLATSGID PVVRLWNPRPESEDLTGRVVEDMEGASQANQRRMNADPLEVMLLNMGYRI TGLSSGGAGASDDEDSSEGQVQCRPS
    • Amino acids
      1 to 676
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161512 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Adipose homolog
    • ADP
    • DCAF9
    • DDB1 and CUL4 associated factor 9
    • KIAA1037
    • WD and tetratricopeptide repeats 1
    • WD and tetratricopeptide repeats protein 1
    see all
  • Relevance
    WDTC1 contains 2 TPR repeats and 7 WD repeats. WDTC1, the ortholog of Drosophila Adipose Gene, associates with human obesity, modulated by MUFA intake. There are six named isoforms.
  • Cellular localization
    Cytosol. Nucleus.

Images

  • ab161512 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161512 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161512.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up