Description

  • Product name

    Recombinant Human WFDC1/PS20 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KPRWLGGNGWLLDGPEEVLQAEACSTTEDGAEPLLCPSGYECHILSPGDV AEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHFQ
    • Amino acids

      121 to 220
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163669 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as WFDC1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Prostate stromal protein ps20
    • PS20
    • ps20 growth inhibitor
    • WAP four disulfide core domain 1
    • WAP four disulfide core domain 1 homolog
    • WAP four-disulfide core domain protein 1
    • Wfdc1
    • WFDC1_HUMAN
    see all
  • Function

    Has growth inhibitory activity.
  • Sequence similarities

    Contains 1 WAP domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab163669 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163669 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163669.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up