For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    recombinant-human-whsc1nsd2-protein-catalytic-domain-ab198120.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling Chromatin Modifying Enzymes Methylation
Share by email

Recombinant human WHSC1/NSD2 protein (Catalytic domain) (ab198120)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Functional Studies - Recombinant human WHSC1/NSD2 protein (Catalytic domain) (ab198120)
  • SDS-PAGE - Recombinant human WHSC1/NSD2 protein (Catalytic domain) (ab198120)

Key features and details

  • Expression system: Escherichia coli
  • Purity: >= 82% SDS-PAGE
  • Active: Yes
  • Tags: GST tag N-Terminus
  • Suitable for: Functional Studies, SDS-PAGE

Description

  • Product name

    Recombinant human WHSC1/NSD2 protein (Catalytic domain)
    See all WHSC1/NSD2 proteins and peptides
  • Biological activity

    Specific Activity: 0.036 pmol/min/μg

    Assay Conditions: Add 50 μL reaction mix (100 μM S-adenosylmethionine, and 50-250 ng WHSC1/NSD2 in HMT buffer 7) to wells coated with the substrate. Incubate at 37oC for 2 hours. Add antibody against methylated K36 residue of histone H3, incubate 1 hour. Then, add secondary HRP-labeled antibody and incubate 30 minutes. Finally, add HRP chemiluminescent substrates and read luminescence.

  • Purity

    >= 82 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

    O96028
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSEGDRGSRYQGVRGIGRVFK NALQEAEARFREIKLQREARETQESERKPPPYKHIKVNKPYGKVQIYTAD ISEIPKCNCKPTDENPCGFDSECLNRMLMFECHPQVCPAGEFCQNQCFTK RQYPETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIKHA HENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDT RVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKTS TTLSSEEKGKKTKKKTRRRRAKGEGKRQSED
    • Predicted molecular weight

      62 kDa including tags
    • Amino acids

      941 to 1240
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      GenBank Accession No. NM_133330

Specifications

Our Abpromise guarantee covers the use of ab198120 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C.

    pH: 8.50
    Constituents: 0.79% Tris HCl, 1.74% Sodium chloride, 0.08% DTT, 0.31% Glutathione, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • FLJ23286
    • IL5 promoter REII region binding protein
    • KIAA1090
    • MGC176638
    • MMSET
    • MMSET type II
    • Multiple myeloma SET domain containing protein type III
    • Multiple myeloma SET domain protein
    • Multiple myeloma SET domain-containing protein
    • NSD 2
    • NSD2
    • NSD2_HUMAN
    • Nuclear receptor binding SET domain protein 2
    • Nuclear SET domain-containing protein 2
    • Probable histone-lysine N-methyltransferase NSD2
    • Protein trithorax-5
    • REIIBP
    • Trithorax/ash1 related protein 5
    • TRX5
    • TRX5 protein
    • WHS
    • Whsc1
    • Wolf Hirschhorn syndrome candidate 1
    • Wolf Hirschhorn syndrome candidate 1 protein
    • Wolf-Hirschhorn syndrome candidate 1 protein
    see all
  • Function

    Probable histone methyltransferase (By similarity). May act as a transcription regulator that binds DNA and suppresses IL5 transcription.
  • Tissue specificity

    Widely expressed.
  • Involvement in disease

    Note=A chromosomal aberration involving WHSC1 is a cause of multiple myeloma tumors. Translocation t(4;14)(p16.3;q32.3) with IgH.
    Note=WHSC1 is located in the Wolf-Hirschhorn syndrome (WHS) critical region. WHS results from by sub-telomeric deletions in the short arm of chromosome 4. WHSC1 is deleted in every case, however deletion of linked genes contributes to both the severity of the core characteristics and the presence of the additional syndromic problems.
  • Sequence similarities

    Belongs to the histone-lysine methyltransferase family. SET2 subfamily.
    Contains 1 AWS domain.
    Contains 1 HMG box DNA-binding domain.
    Contains 4 PHD-type zinc fingers.
    Contains 1 post-SET domain.
    Contains 2 PWWP domains.
    Contains 1 SET domain.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm and Nucleus. Chromosome.
  • Target information above from: UniProt accession O96028 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • Functional Studies - Recombinant human WHSC1/NSD2 protein (Catalytic domain) (ab198120)
    Functional Studies - Recombinant human WHSC1/NSD2 protein (Catalytic domain) (ab198120)

    Specific activity of ab198120 was determined to be 0.036 pmol/min/μg.

  • SDS-PAGE - Recombinant human WHSC1/NSD2 protein (Catalytic domain) (ab198120)
    SDS-PAGE - Recombinant human WHSC1/NSD2 protein (Catalytic domain) (ab198120)

    4-20% SDS-PAGE stained with Coomassie Blue.
    Lane 1: ab198120 (2 µg)
    Lane 2: Protein Marker

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab198120? Please let us know so that we can cite the reference in this datasheet.

    ab198120 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab198120.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.