Description

  • Product name

    Recombinant Human WIF1 protein
    See all WIF1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMP AIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVP HKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQ QAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPG FCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKC PQPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQC QEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPESNYI WVDHHHHHH
    • Predicted molecular weight

      40 kDa including tags
    • Amino acids

      29 to 379
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151810 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 4.00
    Constituents: Sodium Acetate Buffer, 0.88% Sodium chloride, 0.5% CHAPS

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • WIF-1
    • wif1
    • WIF1_HUMAN
    • Wnt inhibitory factor 1
  • Function

    Binds to WNT proteins and inhibits their activities. May be involved in mesoderm segmentation.
  • Sequence similarities

    Contains 5 EGF-like domains.
    Contains 1 WIF domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab151810 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151810.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up