Overview

  • Product name

    Recombinant Human WIPF1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MPVPPPPAPPPPPTFALANTEKPTLNKTEQAGRNALLSDISKGKKLKKTV TNDRSAPILDKPKGAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGGGPPGL GGLFQAGMPKLRSTANRDNHSGGSRPPLLPPGGRSTSAKPFSPPSGPGRF PVPSPGHRSGPPEPQRNRMPPPRPDVGSKPDSIPPPVPSTPRPIQSSLHN RGSPPVPGGPRQPSPGPTPPPPPVRDPPGRSGPLPPPPPVSRNGSTSRAL PATPQLPSRSGVDSPRSGPRPPLPPDRPSAGAPPPPPPSTSIRNGFQDSP CEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESRSGSNRRERGA PPLPPIPR
    • Molecular weight

      63 kDa including tags
    • Amino acids

      1 to 358

Specifications

Our Abpromise guarantee covers the use of ab132512 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AI115543
    • D2Ertd120e
    • MGC111041
    • Protein PRPL-2
    • PRPL 2
    • PRPL-2 protein
    • WAS/WASL interacting protein family member 1
    • WAS/WASL-interacting protein family member 1
    • WAS2
    • WASP-interacting protein
    • WASPIP
    • WIP
    • Wipf1
    • WIPF1_HUMAN
    • Wiskott-Aldrich syndrome protein interacting protein
    • Wiskott-Aldrich syndrome protein-interacting protein
    see all
  • Function

    May have direct activity on the actin cytoskeleton. Induces actin polymerization and redistribution. Contributes with NCK1 and GRB2 in the recruitment and activation of WASL. May participate in regulating the subcellular localization of WASL, resulting in the disassembly of stress fibers in favor of filopodia formation (By similarity). Plays an important role in the intracellular motility of vaccinia virus by functioning as an adapter for recruiting WASL to vaccinia virus.
  • Tissue specificity

    Highly expressed in peripheral blood mononuclear cells, spleen, placenta, small intestine, colon and thymus. Lower expression in ovary, heart, brain, lung, liver, skeletal muscle, kidney, pancreas, prostate and testis.
  • Sequence similarities

    Belongs to the verprolin family.
    Contains 1 WH2 domain.
  • Domain

    Binds to WAS within the N-terminal region 170, at a site distinct from the CDC42-binding site.
  • Cellular localization

    Cytoplasmic vesicle. Cytoplasm > cytoskeleton. Vesicle surfaces and along actin tails. Co-localized with actin stress fibers. When co-expressed with WASL, no longer associated with actin filaments but accumulated in perinuclear and cortical areas like WASL.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132512 stained with Coomassie Blue.

References

ab132512 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132512.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up