Recombinant Human WIPI2 protein (ab153266)

Description

  • Product name

    Recombinant Human WIPI2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNLASQSGEAGAGQLLFANFNQDNTEVKGASRAAGLGRRAVVWSLAVGSK SGYKFFSLSSVDKLEQIYECTDTEDVCIVERLFSSSLVAIVSLKAPRKLK VCHFKKGTEICNYSYSNTILAVKLNRQRLIVCLEESLYIHNIRDMKVLHT IRETPPNPAGLCALSINNDNCYLAYPGSATIGEVQVFDTINLRAANMIPA HDSPLAALAFDASGTKLATASEKGTVIRVFSIPEGQKLFEFRRGVKRCVS ICSLAFSMDGMFLSASSNTETVHIFKLETVKEKPPEEPTTWTGYFGKVLM ASTSYLPSQVTEMFNQGRAFATVRLPFCGHKNICSLATIQKIPRLLVGAA DGYLYMYNLDPQEGGECALMKQHRLDGSLETTNEILDSASHDCPLVTQTY GAAAGKGTYVPSSPTRLAYTDDLGAVGGACLEDEASALRLDEDSEHPPMI LRTD
    • Amino acids

      1 to 454
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153266 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ATG18B
    • Atg21
    • CGI 50
    • DKFZp434J154
    • DKFZp686P02188
    • FLJ12979
    • FLJ14217
    • FLJ42984
    • WD repeat domain phosphoinositide-interacting protein 2
    • WD repeat domain, phosphoinositide interacting 2
    • WD40 repeat protein interacting with phosphoinositides 2
    • WIPI 2
    • WIPI-2
    • WIPI2
    • WIPI2_HUMAN
    • WIPI49 like protein 2
    • WIPI49-like protein 2
    see all
  • Function

    Probable early component of the autophagy machinery being involved in formation of preautophagosomal structures and their maturation into mature phagosomes in response to PtdIns3P. May bind PtdIns3P.
  • Tissue specificity

    Ubiquitously expressed (at protein level). Highly expressed in heart, skeletal muscle and pancreas. Expression is down-regulated in pancreatic and in kidney tumors.
  • Sequence similarities

    Belongs to the WD repeat SVP1 family.
    Contains 3 WD repeats.
  • Cellular localization

    Preautophagosomal structure membrane. Enriched at preautophagosomal structure membranes in response to ptdIns3P.
  • Information by UniProt

Images

  • ab153266 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153266 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153266.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up