Description

  • Product name

    Recombinant human WNK2 protein (Active)
  • Biological activity

    The specific activity of ab205996 was determined to be 2.0 nmol/min/mg.

  • Purity

    > 70 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDGDGGRRDVPGTLMEPGRGAGPAGMAEPRAKAARPGPQRFLRRSVVESD QEEPPGLEAAEAPGPQPPQPLQRRVLLLCKTRRLIAERARGRPAAPAPAA LVAQPGAPGAPADAGPEPVGTQEPGPDPIAAAVETAPAPDGGPREEAAAT VRKEDEGAAEAKPEPGRTRRDEPEEEEDDEDDLKAVATSLDGRFLKFDIE LGRGSFKTVYKGLDTETWVEVAWCELQDRKLTKLERQRFKEEAEMLKGLQ HPNIVRFYDFWESSAKGKRCIVLVTELMTSGTLKTYLKRFKVMKPKVLRS WCRQILKGLLFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKR ASFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQ NAAQIYRKVTCGIKPASFEKVHDPEIKEIIGECICKNKEERYEIKDLLSH AFFAEDTGVRVELAEEDHGRKSTIALRLWVEDPKKLKGK
    • Predicted molecular weight

      100 kDa including tags
    • Amino acids

      1 to 489
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_006648 (which is equivalent to unreviewed UniProt F8W9F9)

Specifications

Our Abpromise guarantee covers the use of ab205996 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Antigen NY-CO-43
    • KIAA1760
    • mitogen-activated protein kinase kinase kinase
    • NY CO 43
    • P/OKcl.13
    • PRKWNK2
    • Protein kinase lysine deficient 2
    • Protein kinase with no lysine 2
    • SDCCAG43
    • Serine/Threonine protein kinase WNK2
    • Serologically defined colon cancer antigen 43
    • WNK lysine deficient protein kinase 2
    see all
  • Relevance

    WNK2 a putative tumour suppressor is a member of a family of serine / threonine protein kinases implicated in the hereditary form of hypertension, pseudohypoaldosteronism type II.
  • Cellular localization

    Cell Membrane and Cytoplasmic

Images

  • SDS-PAGE analysis of ab205996 by densitometry, approximate MW 100 kDa.

  • The specific activity of ab205996 was determined to be 2.0 nmol/min/mg.

References

ab205996 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205996.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up