Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP KQLRFCRNYVEIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGP VLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAICGCSSRHQGSPGKGW KWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMH LKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASEMVVEKHRESR GWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS SHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHT CKNPGSRAGNSAHQPPHPQPPVRFHPPLRRAGKVP
    • Molecular weight

      69 kDa including tags
    • Amino acids

      1 to 385
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      AAI03922.1

Specifications

Our Abpromise guarantee covers the use of ab153563 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Protein Wnt 3a Precursor
    • Protein Wnt-3a
    • Wingless type MMTV integration site family member 3A
    • Wnt 3a
    • wnt3a
    • WNT3A protein
    • WNT3A_HUMAN
    see all
  • Function

    Ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube.
  • Tissue specificity

    Moderately expressed in placenta and at low levels in adult lung, spleen, and prostate.
  • Sequence similarities

    Belongs to the Wnt family.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • ab153563 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153563 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153563.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up