Description

  • Product name

    Recombinant Human Wnt3a protein (His tag)
    See all Wnt3a proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP KQLRFCRNYVMSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCR NYVEIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATR ESAFVHAIASAGVEIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAI FGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAICGCSSRHQGSPG KGWKWGGCSEDIEFGGMVSREFADARENRPDARAFAVTRSCAEGTAAICG CSSRHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHN NEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDS ASESAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAI GDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEAS PNFCEPNPETGSFGTRDRTCNVSMVVEKHRESRGWVETLRPRYTYFKVPT ERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHN ARAERRREKCRCVFHWCCYVSCQECTRVYDVHTCK
    • Predicted molecular weight

      39 kDa
    • Amino acids

      19 to 352
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab204763 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store under desiccating conditions.

  • Reconstitution
    ab204763 should be reconstituted in water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C.

General Info

  • Alternative names

    • Protein Wnt 3a Precursor
    • Protein Wnt-3a
    • Wingless type MMTV integration site family member 3A
    • Wnt 3a
    • wnt3a
    • WNT3A protein
    • WNT3A_HUMAN
    see all
  • Function

    Ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube.
  • Tissue specificity

    Moderately expressed in placenta and at low levels in adult lung, spleen, and prostate.
  • Sequence similarities

    Belongs to the Wnt family.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab204763 under reducing condition and stained with Coomassie blue.

    Lane 1: MW marker

    Lane 2: ab204763

References

ab204763 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204763.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up