Recombinant Human Wnt5a protein (ab204627)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human Wnt5a protein
See all Wnt5a proteins and peptides -
Purity
> 95 % SDS-PAGE.
Purified by Nickel Sepharose HighTrap GE Endotoxin level: < 0.1 ng per µg of Wnt5a -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRH RRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELS TCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGS YESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFR KVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVYIDPSPDYCV RNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH WCCYVKCKKCTEIVDQFVCKLEHHHHH -
Predicted molecular weight
37 kDa including tags -
Amino acids
62 to 380 -
Tags
His tag C-Terminus -
Additional sequence information
NP_003383.2. This product is for the mature full length protein. The signal peptide and propeptide are not included.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab204627 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Additional notes
No direct biological data available at the moment but ab204627 binds to immobilized Human sROR2 in a functional ELISA.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.
Constituent: 0.3% Acetic acid
-
ReconstitutionReconstitute in water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C.
General Info
-
Alternative names
- hWNT 5A
- hWNT5A
- Protein Wnt 5a
see all -
Function
Ligand for members of the frizzled family of seven transmembrane receptors. Can activate or inhibit canonical Wnt signaling, depending on receptor context. In the presence of FZD4, activates beta-catenin signaling. In the presence of ROR2, inhibits the canonical Wnt pathway by promoting beta-catenin degradation through a GSK3-independent pathway which involves down-regulation of beta-catenin-induced reporter gene expression. Suppression of the canonical pathway allows chondrogenesis to occur and inhibits tumor formation. Stimulates cell migration. Decreases proliferation, migration, invasiveness and clonogenicity of carcinoma cells and may act as a tumor suppressor. Mediates motility of melanoma cells. Required during embryogenesis for extension of the primary anterior-posterior axis and for outgrowth of limbs and the genital tubercle. Inhibits type II collagen expression in chondrocytes. -
Tissue specificity
Expression is increased in differentiated thyroid carcinomas compared to normal thyroid tissue and anaplastic thyroid tumors where expression is low or undetectable. Expression is found in thyrocytes but not in stromal cells (at protein level). -
Sequence similarities
Belongs to the Wnt family. -
Post-translational
modificationsPalmitoylation is necessary for stimulation of cell migration, inhibition of the beta-catenin pathway and receptor binding.
Glycosylation is necessary for secretion but not for activity. -
Cellular localization
Secreted > extracellular space > extracellular matrix. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (3)
ab204627 has been referenced in 3 publications.
- Zhou Y et al. Scrapie-Responsive Gene 1 Promotes Chondrogenic Differentiation of Umbilical Cord Mesenchymal Stem Cells via Wnt5a. Stem Cells Int 2022:9124277 (2022). PubMed: 35126528
- Wang Z et al. Cell-Type-Specific Gene Regulatory Networks Underlying Murine Neonatal Heart Regeneration at Single-Cell Resolution. Cell Rep 33:108472 (2020). PubMed: 33296652
- Tian Z et al. The Wnt/ß-catenin signaling pathway affects the distribution of cytoskeletal proteins in Aß treated PC12 cells. J Integr Neurosci 18:309-312 (2019). PubMed: 31601081