Description

  • Product name

    Recombinant Human Wnt5a protein
    See all Wnt5a proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab204627 was determined to be > 95% pure by SDS-PAGE & visualized by silver stain.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRH RRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELS TCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGS YESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFR KVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVYIDPSPDYCV RNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH WCCYVKCKKCTEIVDQFVCKLEHHHHH
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      62 to 380
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_003383.2. This product is for the mature full length protein. The signal peptide and propeptide are not included.

Specifications

Our Abpromise guarantee covers the use of ab204627 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    No direct biological data available at the moment but ab204627 binds to immobilized Human sROR2 in a functional ELISA.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

  • Reconstitution
    Reconstitute in water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C.

General Info

  • Alternative names

    • hWNT 5A
    • hWNT5A
    • Protein Wnt 5a
    • Protein Wnt-5a
    • Protein Wnt5a
    • Wingless type MMTV integration site family member 5A
    • Wnt 5a
    • WNT 5A protein
    • WNT 5A protein precursor
    • WNT5A
    • WNT5A protein precursor
    • WNT5A_HUMAN
    see all
  • Function

    Ligand for members of the frizzled family of seven transmembrane receptors. Can activate or inhibit canonical Wnt signaling, depending on receptor context. In the presence of FZD4, activates beta-catenin signaling. In the presence of ROR2, inhibits the canonical Wnt pathway by promoting beta-catenin degradation through a GSK3-independent pathway which involves down-regulation of beta-catenin-induced reporter gene expression. Suppression of the canonical pathway allows chondrogenesis to occur and inhibits tumor formation. Stimulates cell migration. Decreases proliferation, migration, invasiveness and clonogenicity of carcinoma cells and may act as a tumor suppressor. Mediates motility of melanoma cells. Required during embryogenesis for extension of the primary anterior-posterior axis and for outgrowth of limbs and the genital tubercle. Inhibits type II collagen expression in chondrocytes.
  • Tissue specificity

    Expression is increased in differentiated thyroid carcinomas compared to normal thyroid tissue and anaplastic thyroid tumors where expression is low or undetectable. Expression is found in thyrocytes but not in stromal cells (at protein level).
  • Sequence similarities

    Belongs to the Wnt family.
  • Post-translational
    modifications

    Palmitoylation is necessary for stimulation of cell migration, inhibition of the beta-catenin pathway and receptor binding.
    Glycosylation is necessary for secretion but not for activity.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab204627 under reducing condtions and stained with Coomassie blue.

References

ab204627 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204627.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up