Description

  • Product name

    Recombinant Human Wnt5a protein (His tag)
    See all Wnt5a proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      IIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHR RWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELST CGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGSY ESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRK VGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVYIDPSPDYCVR NESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHW CCYVKCKKCTEIVDQFVCK
    • Predicted molecular weight

      40 kDa including tags
    • Amino acids

      62 to 380
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 62 to 380. The signal peptide and propeptide are not included.

Specifications

Our Abpromise guarantee covers the use of ab236199 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • hWNT 5A
    • hWNT5A
    • Protein Wnt 5a
    • Protein Wnt-5a
    • Protein Wnt5a
    • Wingless type MMTV integration site family member 5A
    • Wnt 5a
    • WNT 5A protein
    • WNT 5A protein precursor
    • WNT5A
    • WNT5A protein precursor
    • WNT5A_HUMAN
    see all
  • Function

    Ligand for members of the frizzled family of seven transmembrane receptors. Can activate or inhibit canonical Wnt signaling, depending on receptor context. In the presence of FZD4, activates beta-catenin signaling. In the presence of ROR2, inhibits the canonical Wnt pathway by promoting beta-catenin degradation through a GSK3-independent pathway which involves down-regulation of beta-catenin-induced reporter gene expression. Suppression of the canonical pathway allows chondrogenesis to occur and inhibits tumor formation. Stimulates cell migration. Decreases proliferation, migration, invasiveness and clonogenicity of carcinoma cells and may act as a tumor suppressor. Mediates motility of melanoma cells. Required during embryogenesis for extension of the primary anterior-posterior axis and for outgrowth of limbs and the genital tubercle. Inhibits type II collagen expression in chondrocytes.
  • Tissue specificity

    Expression is increased in differentiated thyroid carcinomas compared to normal thyroid tissue and anaplastic thyroid tumors where expression is low or undetectable. Expression is found in thyrocytes but not in stromal cells (at protein level).
  • Sequence similarities

    Belongs to the Wnt family.
  • Post-translational
    modifications

    Palmitoylation is necessary for stimulation of cell migration, inhibition of the beta-catenin pathway and receptor binding.
    Glycosylation is necessary for secretion but not for activity.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab236199.

References

ab236199 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236199.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up