Overview

  • Product name

    Recombinant Human WSB1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASFPPRVNEKEIVRLRTIGELLAPAAPFDKKCGRENWTVAFAPDGSYFA WSQGHRTVKLVPWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPR EHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQLLLATGLNNG RIKIWDVYTGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDL KDDGNMMKVLRGHQDWVYSCAFSPDSSMLCSVGASKAVFLWNMDKYTMIR KLEGHHHDVVACDFSPDGALLATASYDTRVYIWDPHNGDILMEFGRLFPP PTPIFAGGANDRWVRSVSFSHDGLHVASLADDKMVRFWRIDEDYPVQVAP LSNGLCCAFSTDGSVLAAGTHDGSVYFWATPRQVPSLQHLCRMSIRRVMP TQEVQELPIPSKLLEFLSYRI
    • Molecular weight

      72 kDa including tags
    • Amino acids

      1 to 421

Specifications

Our Abpromise guarantee covers the use of ab132783 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • SOCS box containing WD protein SWiP 1
    • SWIP1
    • WD repeat and SOCS box containing 1
    • WD repeat and SOCS box containing protein 1
    • WSB 1
    see all
  • Relevance

    WSB1 is a member of the WD-protein subfamily. It shares a high sequence identity to mouse and chick proteins. It contains six WD-repeats spanning most of the protein and an SOCS box in the C-terminus. It is a probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. It recognizes type II iodothyronine deiodinase/DIO2. There are two named isoforms.
  • Cellular localization

    Intracellular

Images

  • 12.5% SDS-PAGE analysis of ab132783 stained with Coomassie Blue.

References

ab132783 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132783.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up