Description

  • Product name

    Recombinant Human WTAP protein
  • Purity

    > 90 % SDS-PAGE.
    ab198661 was expressed in E.coli as inclusion bodies, refolded using unique “temperature shift inclusion body refolding” technology, chromatographically purified and sterile filtered.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGEFMTNEEPLPKKVRLSETDFKVMARDELILRWKQYEA YVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESARRENILVMRLATKEQ EMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKL EQAQNELSAWKFTPDR
    • Predicted molecular weight

      19 kDa including tags
    • Amino acids

      1 to 151
    • Tags

      T7 tag N-Terminus
    • Additional sequence information

      NP_690596.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab198661 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, Sucrose and DTT.

General Info

  • Alternative names

    • DKFZp686F20131
    • Female-lethal(2)D homolog
    • FL2D_HUMAN
    • hFL(2)D
    • KIAA0105
    • MGC3925
    • Mum2
    • OTTHUMP00000017522
    • OTTHUMP00000017523
    • PNAS 132
    • PNAS-132
    • PNAS132
    • Pre mRNA splicing regulator WTAP
    • Pre-mRNA-splicing regulator WTAP
    • Putative pre mRNA splicing regulator female lethal 2D homolog
    • Putative pre mRNA splicing regulator female lethal(2D)
    • Putative pre-mRNA splicing regulator female lethal(2D) homolog
    • putative pre-mRNA splicing regulator female-lethal(2D)
    • Wilms tumor 1 associated protein
    • Wilms tumor 1 associating protein
    • Wilms tumor 1-associating protein
    • Wilms' tumor 1 associating protein
    • Wilms' tumour 1-associating protein
    • WT1 associated protein
    • WT1-associated protein
    • WT1-associating protein
    • wtap
    see all
  • Function

    Regulates G2/M cell-cycle transition by binding to the 3' UTR of CCNA2, which enhances its stability. Impairs WT1 DNA-binding ability and inhibits expression of WT1 target genes. May be involved in mRNA splicing regulation.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the fl(2)d family.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus > nucleolus.
  • Information by UniProt

References

ab198661 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198661.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up