Description

  • Product name

    Recombinant Human Wwp2 protein
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLP SETKKTGKRI GSSELLWNEIIILNVTAQSHLDLKVWSCHTLRNELLGT ASVNLSNVLKNNGGKMENMQLT LNLQTENKGSVVSGGELTIFLDGPTV DLGNVPNGSALTDGSQLPSRDSSGTAVAPENRHQ PPSTNCFGGRSRTH RHSGASARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVNDEPT TA TDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAEGEEPSTSGTQQL PAAAQAPD ALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPGWEKRT DPRGRFYYVDHNTRTTTWQR PTAEYVRNYEQWQSQRNQLQGAMQHFSQ RFLYQSSSASTDHDPLGPLPPGWEKRQDNGRV YYVNHNTRTTQWEDPR TQGMIQEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFE SGTK QGSPGAYDRSFRWKYHQFRFLCHSNALPSHVKISVSRQTLFEDSFQQIMN MKPYDL RRRLYIIMRGEEGLDYGGIAREWFFLLSHEVLNPMYCLFEYA GKNNYCLQINPASSINPD HLTYFRFIGRFIAMALYHGKFIDTGFTLPF YKRMLNKRPTLKDLESIDPEFYNSIVWIKE NNLEECGLELYFIQDMEI LGKVTTHELKEGGESIRVTEENKEEYIMLLTDWRFTRGVEEQ TKAFLD GFNEVAPLEWLRYFDEKELELMLCGMQEIDMSDWQKSTIYRHYTKNSKQI QWFW QVVKEMDNEKRIRLLQFVTGTCRLPVGGFAELIGSNGPQKFCID KVGKETWLPRSHTCFN RLDLPPYKSYEQLREKLLYAIEETEGFGQE
    • Predicted molecular weight

      130 kDa including tags

Specifications

Our Abpromise guarantee covers the use of ab140576 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.31% Glutathione, 0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 0.003% EDTA, 25% Glycerol, 0.29% Sodium chloride

General Info

  • Alternative names

    • AIP2
    • Atrophin 1 interacting protein 2
    • NEDD4 like E3 ubiquitin protein ligase
    • WW domain-containing protein 2
    • Wwp 2
    see all
  • Relevance

    Wwp2 is a HECT domain containing E3 ubiqutin protein ligase. Wwp2 specifically interacts with Rpb1 and is responsible for targeting it for ubiquitination.
  • Cellular localization

    Nuclear

Images

  • Sample Purity Data

References

ab140576 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140576.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up