Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEGDFSVCRNCKRHVVSANFTLHEAYCLRFLVLCPECEEPVPKETMEEHC KLEHQQVGCTMCQQSMQKSSLEFHKANECQERPVECKFCKLDMQLSKLEL HESYCGSRTELCQGCGQFIMHRMLAQHRDVCRSEQAQLGKGERISAPERE IYCHYCNQMIPENKYFHHMGKCCPDSEFKKHFPVGNPEILPSSLPSQAAE NQTSTMEKDVRPKTRSINRFPLHSESSSKKAPRSKNKTLDPLLMSEPKPR TSSPRGDKAAYDILRRCSQCGILLPLPILNQHQEKCRWLASSKGKQVRNF S
    • Molecular weight

      61 kDa including tags
    • Amino acids

      1 to 301

Specifications

Our Abpromise guarantee covers the use of ab132187 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BIRC 4 binding protein
    • BIRC4 binding protein
    • BIRC4-binding protein
    • BIRC4BP
    • HSXIAPAF 1
    • HSXIAPAF1
    • XAF 1
    • XAF1
    • XAF1_HUMAN
    • XIAP associated factor 1
    • XIAP-associated factor 1
    • XIAPAF1
    see all
  • Function

    Seems to function as a negative regulator of members of the IAP (inhibitor of apoptosis protein) family. Inhibits anti-caspase activity of BIRC4. Induces cleavage and inactivation of BIRC4 independent of caspase activation. Mediates TNF-alpha-induced apoptosis and is involved in apoptosis in trophoblast cells. May inhibit BIRC4 indirectly by activating the mitochondrial apoptosis pathway. After translocation to mitochondra, promotes translocation of BAX to mitochondria and cytochrome c release from mitochondria. Seems to promote the redistribution of BIRC4 from the cytoplasm to the nucleus, probably independent of BIRC4 inactivation which seems to occur in the cytoplasm. The BIRC4-XAF1 complex mediates down-regulation of BIRC5/survivin; the process requires the E3 ligase activity of BIRC4. Seems to be involved in cellular sensitivity to the proapoptotic actions of TRAIL. May be a tumor suppressor by mediating apoptosis resistance of cancer cells.
  • Tissue specificity

    Widely expressed. Expression is frequently down-regulated in cancer cell lines. Isoform 5 is widely expressed. Expressed in placenta (at protein level).
  • Sequence similarities

    Contains 1 TRAF-type zinc finger.
  • Developmental stage

    Selectively expressed in third trimester placenta.
  • Cellular localization

    Nucleus and Cytoplasm. Nucleus. Mitochondrion. Found in the cytoplasm and nucleus of placental syncytiotrophoblasts. Translocates to mitochondria upon TNF-alpha treatment.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132187 stained with Coomassie Blue.

References

ab132187 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132187.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up