Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MESPKKKNQQLKVGILHLGSRQKKIRIQLRSQVLGREMRDMEGDLQELHQ SNTGDKSGFGFRRQGEDNT
    • Molecular weight

      34 kDa including tags
    • Amino acids

      1 to 69

Specifications

Our Abpromise guarantee covers the use of ab133008 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cancer/testis antigen 12.1
    • CT12.1
    • G antigen family D 2 protein
    • G antigen family D member 2
    • GAGD2_HUMAN
    • GAGED2
    • Protein XAGE-1
    • X antigen family, member 1
    • XAGE1A
    • XAGE1B
    • XAGE1C
    • XAGE1D
    • XAGE1E
    see all
  • Tissue specificity

    In normal tissues, highly expressed in testis. Expressed also in many different types of cancers: highly expressed in breast cancer, prostate cancer and many types of lung cancers, including squamous cell carcinoma, small cell carcinoma, non-small cell carcinoma, and adenocarcinoma, as well as in Ewing's cell lines, in some Ewing's sarcoma patient samples, and in one of one alveolar rhabdomyosarcoma patient sample.
  • Sequence similarities

    Belongs to the GAGE family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab133008 stained with Coomassie Blue.

References

ab133008 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab133008.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up