Recombinant Human Xanthine Oxidase protein (ab159820)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: ELISA, WB
Description
-
Product name
Recombinant Human Xanthine Oxidase protein -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
GSIPIEFRVSLLRDCPNKKAIYASKAVGEPPLFLAASIFFAIKDAIRAAR AQHTGNNVKELFRLDSPATPEKIRNACVDKFTTLCVTGVPENCKPWSVR -
Amino acids
1234 to 1332 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab159820 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Western blot
-
Form
Liquid -
Additional notes
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- Xanthine dehydrogenase
- Xanthine dehydrogenase/oxidase
- Xanthine oxidase
see all -
Function
Key enzyme in purine degradation. Catalyzes the oxidation of hypoxanthine to xanthine. Catalyzes the oxidation of xanthine to uric acid. Contributes to the generation of reactive oxygen species. Has also low oxidase activity towards aldehydes (in vitro). -
Tissue specificity
Detected in milk (at protein level). -
Involvement in disease
Defects in XDH are the cause of xanthinuria type 1 (XU1) [MIM:278300]. Xanthinuria is characterized by excretion of very large amounts of xanthine in the urine and a tendency to form xanthine stones. Uric acid is strikingly diminished in serum and urine. XU1 is due to isolated xanthine dehydrogenase. XU1 patients can metabolize allopurinol. -
Sequence similarities
Belongs to the xanthine dehydrogenase family.
Contains 1 2Fe-2S ferredoxin-type domain.
Contains 1 FAD-binding PCMH-type domain. -
Post-translational
modificationsSubject to partial proteolysis; this alters the enzyme from the dehydrogenase form (D) to the oxidase form (O).
Contains sulfhydryl groups that are easily oxidized (in vitro); this alters the enzyme from the dehydrogenase form (D) to the oxidase form (O). -
Cellular localization
Cytoplasm. Peroxisome. Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab159820 has not yet been referenced specifically in any publications.