Overview

  • Product name

    Recombinant Human Xanthine Oxidase protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      GSIPIEFRVSLLRDCPNKKAIYASKAVGEPPLFLAASIFFAIKDAIRAAR AQHTGNNVKELFRLDSPATPEKIRNACVDKFTTLCVTGVPENCKPWSVR
    • Amino acids

      1234 to 1332
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159820 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Xanthine dehydrogenase
    • Xanthine dehydrogenase/oxidase
    • Xanthine oxidase
    • Xanthine oxidoreductase
    • XD
    • XDH
    • XDH_HUMAN
    • xdha
    • XO
    • xor
    see all
  • Function

    Key enzyme in purine degradation. Catalyzes the oxidation of hypoxanthine to xanthine. Catalyzes the oxidation of xanthine to uric acid. Contributes to the generation of reactive oxygen species. Has also low oxidase activity towards aldehydes (in vitro).
  • Tissue specificity

    Detected in milk (at protein level).
  • Involvement in disease

    Defects in XDH are the cause of xanthinuria type 1 (XU1) [MIM:278300]. Xanthinuria is characterized by excretion of very large amounts of xanthine in the urine and a tendency to form xanthine stones. Uric acid is strikingly diminished in serum and urine. XU1 is due to isolated xanthine dehydrogenase. XU1 patients can metabolize allopurinol.
  • Sequence similarities

    Belongs to the xanthine dehydrogenase family.
    Contains 1 2Fe-2S ferredoxin-type domain.
    Contains 1 FAD-binding PCMH-type domain.
  • Post-translational
    modifications

    Subject to partial proteolysis; this alters the enzyme from the dehydrogenase form (D) to the oxidase form (O).
    Contains sulfhydryl groups that are easily oxidized (in vitro); this alters the enzyme from the dehydrogenase form (D) to the oxidase form (O).
  • Cellular localization

    Cytoplasm. Peroxisome. Secreted.
  • Information by UniProt

Images

  • ab159820 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159820 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159820.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up