Description

  • Product name

    Recombinant human XCL2 protein
  • Biological activity

    Activity verified by intracellular calcium flux using HEK 293 cells.

  • Purity

    > 98 % SDS-PAGE.
    >98% by SDS-PAGE, HPLC, MALDI-MS and NMR analysis. Activity verified by intracellular calcium flux using HEK 293 cells.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      VGSEVSHRRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCAD PQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
    • Predicted molecular weight

      10 kDa
    • Amino acids

      22 to 114
    • Additional sequence information

      This protein is expressed in E. coli then processed, refolded and purified to yield the native, secreted form of the mature chemokine. Mature chain lacling the signal peptide.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab229847 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Other

    Mass Spectrometry

    HPLC

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Add deionized water to desired volume, aliquot and freeze unused portion.

General Info

  • Relevance

    Chemotactic activity for lymphocytes but not for monocytes or neutrophils.
  • Cellular localization

    Secreted

Images

  • Mass spectrometric analysis of ab229847.

References

ab229847 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229847.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up