Description

  • Product name

    Recombinant human XIAP protein
    See all XIAP proteins and peptides
  • Biological activity

    Assay Conditions: 50 mM Tris-HCl, pH 7.4, 25 mM NaCl, 0.05% Tween-20, 0.01% BSA, 0.5 nM FAM-SMAC peptide. Incubate 30 minutes at room temperature. Fluorescence polarization is measured at exc 475 nm, em 528 nm.

  • Purity

    >= 60 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHHHHHHYLGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYS EEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNWEP CDRAWSEHRRHFPNCFFVLGRNLNIRSESDAVSSDRNFPNSTNLPRNPSM ADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKP SEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT
    • Predicted molecular weight

      28 kDa including tags
    • Amino acids

      120 to 356
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Bir2 and Bir3 domains; NM_001167.

Specifications

Our Abpromise guarantee covers the use of ab198451 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Preservative: 1.36% Imidazole
    Constituents: 20% Glycerol, 0.63% Tris HCl, 0.02% Potassium chloride, 0.64% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • AP 13
    • API3
    • Apoptosis Inhibitor 3
    • Baculoviral IAP repeat containing 4
    • Baculoviral IAP Repeat Containing Protein 4
    • Baculoviral IAP repeat-containing protein 4
    • BIRC 4
    • BIRC4
    • E3 ubiquitin-protein ligase XIAP
    • hIAP-3
    • hIAP3
    • HILP
    • IAP 3
    • IAP like protein
    • IAP-3
    • IAP-like protein
    • IAP3
    • ILP
    • ILP 1
    • ILP1
    • Inhibitor of apoptosis protein 3
    • Inhibitor of Apoptosis X Linked
    • Mammalian IAP Homologue A
    • MIHA
    • X linked IAP
    • X linked inhibitor of apoptosis
    • X linked inhibitor of apoptosis E3 ubiquitin protein ligase
    • X linked inhibitor of apoptosis protein
    • X-linked IAP
    • X-linked inhibitor of apoptosis protein
    • Xiap
    • XIAP_HUMAN
    • XLP2
    see all
  • Function

    Apoptotic suppressor. Has E3 ubiquitin-protein ligase activity. Mediates the proteasomal degradation of target proteins, such as caspase-3, SMAC or AIFM1. Inhibitor of caspase-3, -7 and -9. Mediates activation of MAP3K7/TAK1, leading to the activation of NF-kappa-B.
  • Tissue specificity

    Ubiquitous, except peripheral blood leukocytes.
  • Involvement in disease

    Defects in XIAP are the cause of lymphoproliferative syndrome X-linked type 2 (XLP2) [MIM:300635]. XLP is a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus (EBV). Symptoms include severe or fatal mononucleosis, acquired hypogammaglobulinemia, pancytopenia and malignant lymphoma.
  • Sequence similarities

    Belongs to the IAP family.
    Contains 3 BIR repeats.
    Contains 1 RING-type zinc finger.
  • Domain

    The first BIR domain is involved in interaction with TAB1/MAP3K7IP1 and is important for dimerization. The second BIR domain is sufficient to inhibit caspase-3 and caspase-7, while the third BIR is involved in caspase-9 inhibition. The interactions with SMAC and PRSS25 are mediated by the second and third BIR domains.
  • Post-translational
    modifications

    Ubiquitinated and degraded by the proteasome in apoptotic cells.
    Phosphorylation by PKB/AKT protects XIAP against ubiquitination and protects the protein against proteasomal degradation.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of 1.8μg ab198451 with Coomassie staining.

  • Binding activity assay using ab198451.

References

ab198451 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198451.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up