Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      PPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRA FVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTP TQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLV DKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTA LDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHL LLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSET IPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKE VPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPE TNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGH IAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGP CGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNF NNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQ KQGRQEALEWLIRETQPISKQH
    • Molecular weight

      70 kDa
    • Amino acids

      2 to 623

Associated products

Specifications

Our Abpromise guarantee covers the use of ab151364 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.Supplied as a 0.2 µM filtered solution.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • Aminoacylproline aminopeptidase
    • aminopeptidase P, cytosolic
    • APP1
    • Cytosolic aminopeptidase P
    • RP11 451M19.1
    • sAmp
    • soluble
    • Soluble aminopeptidase P
    • X Pro aminopeptidase 1
    • X prolyl aminopeptidase (aminopeptidase P) 1
    • X prolyl aminopeptidase (Aminopeptidase P) 1 soluble
    • X prolyl aminopeptidase 1
    • X prolyl aminopeptidase 1 soluble
    • X-Pro aminopeptidase 1
    • X-prolyl aminopeptidase 1
    • Xaa Pro aminopeptidase 1
    • Xaa-Pro aminopeptidase 1
    • XPNPEP
    • XPNPEP 1
    • xpnpep1
    • XPNPEPL
    • XPNPEPL1
    • XPP1_HUMAN
    see all
  • Function

    Contributes to the degradation of bradykinin. Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro.
  • Tissue specificity

    Expressed in all tissues tested, including pancreas, heart, muscle, kidney, liver, lung and brain. Highest levels in pancreas.
  • Sequence similarities

    Belongs to the peptidase M24B family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

References

ab151364 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up