Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGEFGSTSMAASRKPPRVRVNHQDFQLRNLRIIEPNEVT HSGDTGVETDGRMPPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAH QSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDS NWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRS AGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLK MAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFID GDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKV WVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDA VALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTG PNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTA YEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTG HGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIEN VVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNY HLTCRDVIGKELQKQGRQEALEWLIRETQPISKQH
    • Molecular weight
      77 kDa including tags
    • Amino acids
      1 to 666
    • Tags
      T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab169911 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab169911 was expressed in E.coli as inclusion bodies. The final product was refolded and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Contains NaCl, KCl, EDTA, arginine, DTT and glycerol.

General Info

  • Alternative names
    • Aminoacylproline aminopeptidase
    • aminopeptidase P, cytosolic
    • APP1
    • Cytosolic aminopeptidase P
    • RP11 451M19.1
    • sAmp
    • soluble
    • Soluble aminopeptidase P
    • X Pro aminopeptidase 1
    • X prolyl aminopeptidase (aminopeptidase P) 1
    • X prolyl aminopeptidase (Aminopeptidase P) 1 soluble
    • X prolyl aminopeptidase 1
    • X prolyl aminopeptidase 1 soluble
    • X-Pro aminopeptidase 1
    • X-prolyl aminopeptidase 1
    • Xaa Pro aminopeptidase 1
    • Xaa-Pro aminopeptidase 1
    • XPNPEP
    • XPNPEP 1
    • xpnpep1
    • XPNPEPL
    • XPNPEPL1
    • XPP1_HUMAN
    see all
  • Function
    Contributes to the degradation of bradykinin. Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro.
  • Tissue specificity
    Expressed in all tissues tested, including pancreas, heart, muscle, kidney, liver, lung and brain. Highest levels in pancreas.
  • Sequence similarities
    Belongs to the peptidase M24B family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab169911 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169911.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up