Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MDEQALLGLNPNADSDFRQRALAYFEQLKISPDAWQVCAEALAQRTYSDD HVKFFCFQVLEHQVKYKYSELTTVQQQLIRETLISWLQAQMLNPQPEKTF IRNKAAQVFALLFVTEYLTKWPKFFFDILSVVDLNPRGVDLYLRILMAID SELVDRDVVHTSEEARRNTLIKDTMREQCIPNLVESWYQILQNYQFTNSE VTCQCLEVVGAYVSWIDLSLIANDRFINMLLGHMSIEVLREEACDCLFEV VNKGMDPVDKMKLVESLCQVLQSAGFFSIDQEEDVDFLARFSKLVNGMGQ SLIVSWSKLIKNGDIKNAQEALQAIETKVALMLQLLIHEDDDISSNIIGF CYDYLHILKQLTVLSDQQKANVEAIMLAVMKKLTYDEEYNFENEGEDEAM FVEYRKQLKLLLDRLAQVSPELLLASVRRVFSSTLQNWQTTRFMEVEVAI RLLYMLAEALPVSHGAHFSGDVSKASALQDMMRTLVTSGVSSYQHTSVTL EFFETVVRYEKFFTVEPQHIPCVLMAFLDHRGLRHSSAKVRSRTAYLFSR FVKSLNKQMNPFIEDILNRIQDLLELSPPENGHQSLLSSDDQLFIYETAG VLIVNSEYPAERKQALMRNLLTPLMEKFKILLEKLMLAQDEERQASLADC LNHAVGFASRTSKAFSNKQTVKQCGCSEVYLDCLQTFLPALSCPLQKDIL RSGVRTFLHRMIICLEEEVLPFIPSASEHMLKDCEAKDLQEFIPLINQIT AKFKIQVSPFLQQMFMPLLHAIFEVLLRPAEENDQSAALEKQMLRRSYFA FLQTVTGSGMSEVIANQGAENVERVLVTVIQGAVEYPDPIAQKTCFIILS KLVELWGGKDGPVGFADFVYKHIVPACFLAPLKQTFDLADAQTVLALSEC AVTLKTIHLKRGPECVQYLQQEYLPSLQVAPEIIQEFCQALQQPDAKVFK NYLKVFFQRAKP
    • Amino acids

      1 to 962
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161383 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as Exportin T

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 1110004L07Rik
    • 3110065H13Rik
    • AI452076
    • C79645
    • Exportin tRNA
    • Exportin(tRNA)
    • Exportin-T
    • Nuclear export receptor for tRNAs
    • tRNA exportin
    • XPO3
    • xpot
    • XPOT_HUMAN
    see all
  • Function

    Mediates the nuclear export of aminoacylated tRNAs. In the nucleus binds to tRNA and to the GTPase Ran in its active GTP-bound form. Docking of this trimeric complex to the nuclear pore complex (NPC) is mediated through binding to nucleoporins. Upon transit of a nuclear export complex into the cytoplasm, disassembling of the complex and hydrolysis of Ran-GTP to Ran-GDP (induced by RANBP1 and RANGAP1, respectively) cause release of the tRNA from the export receptor. XPOT then return to the nuclear compartment and mediate another round of transport. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus.
  • Sequence similarities

    Belongs to the exportin family.
  • Cellular localization

    Nucleus. Cytoplasm. Nuclear, once bound to tRNA and Ran the complex translocates to the cytoplasm. Shuttles between the nucleus and the cytoplasm.
  • Information by UniProt

Images

  • ab161383 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161383 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161383.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up