Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      LPVPELPDFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDYMSDRVQF VITAQEWDPSFEEALMDNPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA
    • Molecular weight

      37 kDa including tags
    • Amino acids

      534 to 633

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152807 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DNA repair protein XRCC1
    • RCC
    • X ray repair complementing defective repair in chinese hamster
    • X ray Repair Complementing Defective Repair in Chinese Hamster Cells
    • X ray repair complementing defective repair in chinese hamster cells 1
    • X ray repair cross complementing 1
    • X ray repair cross complementing protein 1
    • X ray repair, complementing defective, repair in Chinese hamster
    • X-ray repair cross-complementing protein 1
    • XRCC 1
    • Xrcc1
    • XRCC1_HUMAN
    see all
  • Function

    Corrects defective DNA strand-break repair and sister chromatid exchange following treatment with ionizing radiation and alkylating agents.
  • Sequence similarities

    Contains 2 BRCT domains.
  • Post-translational
    modifications

    Phosphorylation of Ser-371 causes dimer dissociation. Phosphorylation by CK2 promotes interaction with APTX and APLF.
    Sumoylated.
  • Cellular localization

    Nucleus. Accumulates at sites of DNA damage.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152807 stained with Coomassie Blue.

References

ab152807 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152807.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up