Description

  • Product name

    Recombinant Human XRCC3 protein (denatured)
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMDLDLLDLNPRIIAAIKKAKLKSVKEVLHF SGPDLKRLTNLSSPEVWHLLRTASLHLRGSSILTALQLHQQKERFPTQHQ RLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQH GGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDVPGELLQKLRFGSQIF IEHVADVDTLLECVNKKVPVLLSRGMARLVVIDSVAAPFRCEFDSQASAP RARHLQSLGATLRELSSAFQSPVLCINQVTEAMEEQGAAHGPLGFWDERV SPALGITWANQLLVRLLADRLREEEAALGCPARTLRVLSAPHLPPSSCSY TISAEGVRGTPGTQSH
    • Predicted molecular weight

      40 kDa including tags
    • Amino acids

      1 to 346
    • Tags

      His tag N-Terminus
  • Description

    Recombinant Human XRCC3 protein

Specifications

Our Abpromise guarantee covers the use of ab139221 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • CMM6
    • DNA repair protein XRCC3
    • RAD51 like
    • X ray repair complementing defective repair in Chinese hamster
    • X ray repair complementing defective repair in Chinese hamster cells 3
    • X ray repair cross complementing protein 3
    • X-ray repair cross-complementing protein 3
    • XRCC 3
    • XRCC3
    • XRCC3_HUMAN
    see all
  • Function

    Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA, thought to repair chromosomal fragmentation, translocations and deletions. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51 and RAD51C.
  • Sequence similarities

    Belongs to the RecA family. RAD51 subfamily.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus. Cytoplasm. Cytoplasm > perinuclear region. Mitochondrion. Accumulates in discrete nuclear foci prior to DNA damage, and these foci persist throughout the time course of DNA repair.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab139221.

References

ab139221 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139221.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up