Overview

  • Product name

    Recombinant Human XTP3TPA protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHMSVAGGEIRGDTGGEDTAAPGRFSFS PEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTD GEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINR RRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST
    • Molecular weight

      21 kDa including tags
    • Amino acids

      1 to 170
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab119438 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab119438 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • CDA03
    • dCTP pyrophosphatase 1
    • DCTP1_HUMAN
    • dCTPase 1
    • DCTPP1
    • Deoxycytidine triphosphatase 1
    • Deoxycytidine-triphosphatase 1
    • RS21C6
    • XTP3 transactivated gene A protein
    • XTP3 transactivated protein A
    • XTP3-transactivated gene A protein
    see all
  • Function

    Hydrolyzes deoxynucleoside triphosphates (dNTPs) to the corresponding nucleoside monophosphates. Has a strong preference for modified dCTP. Activity is highest with 5-iodo-dCTP, followed by 5-bromo-dCTP, unmodified dCTP, 5-methyl-dCTP and 5-chloro-dCTP. Hydrolyzes 2-chloro-dATP and 2-hydroxy-dATP with lower efficiency, and has even lower activity with unmodified dATP, dTTP and dUTP (in vitro). Does not hydrolyze ATP, UTP, ITP, GTP, dADP, dCDP or dGTP. May protect DNA or RNA against the incorporation of non-canonical nucleotide triphosphates. May protect cells against inappropriate methylation of CpG islands by DNA methyltransferases.
  • Sequence similarities

    Contains 1 EAR repeat.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12% SDS-PAGE Coomassie gel showing ab119348, 3µg.

References

ab119438 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab119438.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up