Description

  • Product name

    Recombinant human Yes1 (mutated T348 I) protein
    See all Yes1 proteins and peptides
  • Biological activity

    The specific activity of ab207151 was determined to be 50 nmol/min/mg.

  • Purity

    > 80 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGT AVNFSSLSMTPFGGSSGVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALY DYEARTTEDLSFKKGERFQIINNTEGDWWEARSIATGKNGYIPSNYVAPA DSIQAEEWYFGKMGRKDAERLLLNPGNQRGIFLVRESETTKGAYSLSIRD WDEIRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHYTEHADGLCHK LTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTT KVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVI EFMSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLR AANILVGENLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGR FTIKSDVWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCP ESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGENL
    • Predicted molecular weight

      88 kDa including tags
    • Amino acids

      1 to 543
    • Modifications

      mutated Y348 I
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_005433.3.

Specifications

Our Abpromise guarantee covers the use of ab207151 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • c Yes
    • Cellular Yes 1 protein
    • Cellular Yes1 protein
    • HsT441
    • P61 YES
    • p61-Yes
    • Proto oncogene tyrosine protein kinase YES
    • Proto-oncogene c-Yes
    • Tyrosine-protein kinase Yes
    • v yes 1 Yamaguchi sarcoma viral oncogene homolog 1
    • Viral oncogene yes 1 homolog 1
    • Viral oncogene yes1 homolog 1
    • Yamaguchi sarcoma oncogene
    • Yes
    • Yes 1
    • YES proto oncogene 1, Src family tyrosine kinase
    • YES_HUMAN
    • YES1
    • YES1 proto oncogene, Src family tyrosine kinase
    see all
  • Function

    Promotes infectivity of Neisseria gonorrhoeae in epithelial cells by phosphorylating MCP/CD46.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. SRC subfamily.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
    Contains 1 SH3 domain.
  • Post-translational
    modifications

    Autophosphorylated.
  • Cellular localization

    Cytoplasm > cytosol. In epithelial cells infected with Neisseria gonorrhoeae, forms aggregates beneath bacterial microcolonies.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab207151, which was determined to be >80% pure by densitometry.

  • The specific activity of ab207151 was determined to be 50 nmol/min/mg.

References

ab207151 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207151.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up