Description

  • Product name

    Recombinant Human YL1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSLAGGRAPRKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQ SDTEDEVDSDFDIDEGDEPSSDGEAEEPRRKRRVVTKAYKEPLKSLRPRK VNTPAGSSQKAREEKALLPLELQDDGSDSRKSMRQSTAEHTRQTFLRVQE RQGQSRRRKGPHCERPLTQEELLREAKITEELNLRSLETYERLEADKKKQ VHKKRKCPGPIITYHSVTVPLVGEPGPKEENVDIEGLDPAPSVSALTPHA GTGPVNPPARCSRTFITFSDDATFEEWFPQGRPPKVPVREVCPVTHRPAL YRDPVTDIPYATARAFKIIREAYKKYITAHGLPPTASALGPGPPPPEPLP GSGPRALRQKIVIK
    • Amino acids

      1 to 364
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159653 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CFL1
    • HGNC11644
    • Protein YL-1
    • Swc2
    • TCFL1
    • Transcription Factor Like 1
    • Transcription factor like 1 (YL1)
    • Transcription factor-like 1
    • Vacuolar protein sorting 72 (yeast)
    • Vacuolar protein sorting 72 homolog (S. cerevisiae)
    • Vacuolar protein sorting associated protein 72 homolog
    • Vacuolar protein sorting-associated protein 72 homolog
    • VPS72
    • VPS72_HUMAN
    • YL-1
    • YL1
    see all
  • Function

    Could be a DNA-binding transcriptional regulator. May be involved in chromatin modification and remodeling.
  • Sequence similarities

    Belongs to the VPS72/YL1 family.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab159653 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159653 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159653.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up