Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EILKWYLNKIKFDQSVDPEIIARGTVGFSGAELENLVNQAALKAAVDGKE MVTMKELEFSKDKILMGPERRSVEIDNKNKTITAYHESGHAIIAYYTKD
    • Amino acids
      514 to 612
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161124 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as ATP-dependent metalloprotease YME1L1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP dependent metalloprotease FtsH1 homolog
    • ATP-dependent metalloprotease FtsH1
    • ATP-dependent metalloprotease YME1L1
    • ATP-dependent zinc metalloprotease YME1L1
    • FTSH1
    • Meg-4
    • MEG4
    • PAMP
    • Presenilin-associated metalloprotease
    • UNQ1868/PRO4304
    • YME1 like 1
    • YME1-like protein 1
    • YME1L
    • Yme1l1
    • YMEL1_HUMAN
    see all
  • Function
    Putative ATP-dependent protease which plays a role in mitochondrial protein metabolism. Ensures cell proliferation, maintains normal cristae morphology and complex I respiration activity, promotes antiapoptotic activity and protects mitochondria from the accumulation of oxidatively damaged membrane proteins. Requires to control the accumulation of nonassembled respiratory chain subunits (NDUFB6, OX4 and ND1). Seems to act in the processing of OPA1.
  • Tissue specificity
    High expression in cardiac and skeletal muscle mitochondria.
  • Sequence similarities
    In the N-terminal section; belongs to the AAA ATPase family.
    In the C-terminal section; belongs to the peptidase M41 family.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab161124 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161124 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161124.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up