Description

  • Product name

    Recombinant Human YOD1 protein
  • Purity

    > 90 % SDS-PAGE.
    ab140732 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMFGPAKGRHFGVHPAPGFPGGVSQQAA GTKAGPAGAWPVGSRTDTMWRLRCKAKDGTHVLQGLSSRTRVRELQGQIA AITGIAPGGQRILVGYPPECLDLSNGDTILEDLPIQSGDMLIIEEDQTRP RSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPA CAPEMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISI LSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPD PDTPPLTIFSSNDDIVLVQALELADEARRRRQFTDVNRFTLRCMVCQKGL TGQAEAREHAKETGHTNFGEV
    • Predicted molecular weight

      41 kDa including tags
    • Amino acids

      1 to 348
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab140732 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 30% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • DUBA-8
    • DUBA8
    • HIN-7
    • HIV-1-induced protease 7
    • HsHIN7
    • OTU domain containing 2
    • OTU domain-containing protein 2
    • OTU1_HUMAN
    • OTUD2
    • PRO0907
    • RP11-164O23.1
    • Ubiquitin thioesterase OTU1
    • yod1
    • YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae)
    • YOD1 OTU deubiquinating enzyme 1 homolog (yeast)
    • YOD1 OTU deubiquinating enzyme 1, S. cerevisiae, homolog of
    see all
  • Function

    Hydrolase that can remove conjugated ubiquitin from proteins and participates in endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal proteins. May act by triming the ubiquitin chain on the associated substrate to facilitate their threading through the VCP/p97 pore. Ubiquitin moieties on substrates may present a steric impediment to the threading process when the substrate is transferred to the VCP pore and threaded through VCP's axial channel. Mediates deubiquitination of both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. Able to cleave both polyubiquitin and di-ubiquitin.
  • Sequence similarities

    Contains 1 C2H2-type zinc finger.
    Contains 1 OTU domain.
  • Domain

    The UBAX-like region mediates the interaction with VCP. According to PubMed:19818707, it corresponds to a UBX domain, which is a hallmark for VCP-associated proteins. However, no canonical UBX is detected by prediction tools such as Pfam or PROSITE.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab140732 (3µg).

References

ab140732 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140732.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up