Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMDDREDLVYQAKLAEQAERYDEMVESMKKV AGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLK MIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHR YLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTL WTSDMQGDGEEQNKEALQDVEDENQ
    • Molecular weight

      31 kDa including tags
    • Amino acids

      1 to 255
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_006752.

Specifications

Our Abpromise guarantee covers the use of ab219215 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab219215 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as 14-3-3 epsilon

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, 0.02% DTT, 89% PBS

General Info

  • Alternative names

    • 14 3 3 E
    • 14 3 3 epsilon
    • 14 3 3E
    • 14-3-3 protein epsilon
    • 14-3-3E
    • 1433E_HUMAN
    • Epididymis luminal protein 2
    • FLJ45465
    • FLJ53559
    • HEL2
    • KCIP 1
    • KCIP1
    • MDCR
    • MDS
    • Mitochondrial import stimulation factor L subunit
    • Protein kinase C inhibitor protein1
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, epsilon
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, epsilon polypeptide
    • Tyrosine 3/tryptophan 5 monooxygenase activation protein epsilon polypeptide
    • YWHAE
    see all
  • Function

    Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.
  • Sequence similarities

    Belongs to the 14-3-3 family.
  • Cellular localization

    Cytoplasm. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab219215.

References

ab219215 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219215.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up