Description

  • Product name

    Recombinant Human YY1 protein
    See all YY1 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDD DEDGGGGDHGGGGGHGHAGHHHHHHHHHHHPPMIALQPLVTDDPTQVHHH QEVILVQTREEVVGGDDSDGLRAEDGFEDQILIPVPAPAGGDDDYIEQTL VTVAAAGKSGGGGSSSSGGGRVKKGGGKKSGKKSYLSGGAGAAGGGGADP GNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQIIGENSPPD YSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPH KGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGE KPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNL KSHILTHAKAKNNQ
    • Predicted molecular weight

      71 kDa including tags
    • Amino acids

      1 to 414
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152809 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CF1
    • Delta
    • Delta transcription factor
    • INO80 complex subunit S
    • INO80S
    • NF E1
    • NF-E1
    • NFE1
    • OTTHUMP00000197459
    • Transcriptional repressor protein YY1
    • TYY1_HUMAN
    • UCR motif DNA binding protein
    • UCRBP
    • Yin and yang 1
    • Yin and Yang 1 protein
    • Yin Yang 1
    • Ying Yang 1
    • YY 1
    • YY 1 transcription factor
    • YY-1
    • YY1
    • YY1 transcription factor
    see all
  • Function

    Multifunctional transcription factor that exhibits positive and negative control on a large number of cellular and viral genes by binding to sites overlapping the transcription start site. May play an important role in development and differentiation. The function of YY1 as an activator or a repressor is specified by the presence of other proteins. For example it acts as a repressor in absence of adenovirus E1A protein but as an activator in its presence.
  • Sequence similarities

    Belongs to the YY transcription factor family.
    Contains 4 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus matrix. Associated with the nuclear matrix.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152809 stained with Coomassie Blue.

References

ab152809 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152809.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up