Description

  • Product name

    Recombinant Human YY1 protein (His tag)
    See all YY1 proteins and peptides
  • Purity

    > 80 % SDS-PAGE.
    ab187479 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMASGDTLYIATDGSEMPAEIVELHEIE VETIPVETIETTVVGEEEEEDDDDEDGGGGDHGGGGGHGHAGHHHHHHHH HHHPPMIALQPLVTDDPTQVHHHQEVILVQTREEVVGGDDSDGLRAEDGF EDQILIPVPAPAGGDDDYIEQTLVTVAAAGKSGGGGSSSSGGGRVKKGGG KKSGKKSYLSGGAGAAGGGGADPGNKKWEQKQVQIKTLEGEFSVTMWSSD EKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLA EFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVC AECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIH TGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNNQ
    • Predicted molecular weight

      47 kDa including tags
    • Amino acids

      1 to 414
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_003394.

Specifications

Our Abpromise guarantee covers the use of ab187479 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 20% Glycerol, 0.02% DTT, 79% PBS

General Info

  • Alternative names

    • CF1
    • Delta
    • Delta transcription factor
    • INO80 complex subunit S
    • INO80S
    • NF E1
    • NF-E1
    • NFE1
    • OTTHUMP00000197459
    • Transcriptional repressor protein YY1
    • TYY1_HUMAN
    • UCR motif DNA binding protein
    • UCRBP
    • Yin and yang 1
    • Yin and Yang 1 protein
    • Yin Yang 1
    • Ying Yang 1
    • YY 1
    • YY 1 transcription factor
    • YY-1
    • YY1
    • YY1 transcription factor
    see all
  • Function

    Multifunctional transcription factor that exhibits positive and negative control on a large number of cellular and viral genes by binding to sites overlapping the transcription start site. May play an important role in development and differentiation. The function of YY1 as an activator or a repressor is specified by the presence of other proteins. For example it acts as a repressor in absence of adenovirus E1A protein but as an activator in its presence.
  • Sequence similarities

    Belongs to the YY transcription factor family.
    Contains 4 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus matrix. Associated with the nuclear matrix.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 μg ab187479.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187479.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up